Loading...
Statistics
Advertisement

rostocker-fruehling – Initiative für Demokratie und Umweltschutz ...
www.rostocker-fruehling.de/
diese website ist grad in Überarbeitung ...   Rettet die Natur in den Wall-Anlagen vor den Umbauten! Liebe Freundinnen und Freunde des rostocker frühling ...

Rostocker-fruehling.de

Domain is redirected to: Rostockerfruehlingdotcom.wordpress.com
Advertisement
Rostocker-fruehling.de is hosted in United States / San Francisco . Rostocker-fruehling.de uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 4. First javascripts: Gprofiles.js, Wpgroho.js, 725X1342.skimlinks.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: Apache. Its CMS is: Wordpress.

Technologies in use by Rostocker-fruehling.de

Technology

Number of occurences: 8
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 4
  • gprofiles.js
  • wpgroho.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • Apache

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Rostocker-fruehling.de

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL Wildcard/CN=*.c.artfiles.de
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL Wildcard
      • CN: *.c.artfiles.de
    • hash: c7d3b224
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 58884198581449894650877572006545593890
    • validFrom: 140210000000Z
    • validTo: 190209235959Z
    • validFrom_time_t: 1391990400
    • validTo_time_t: 1549756799
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: BF:FE:E1:C3:37:A0:C3:60:93:76:DD:88:24:45:73:14:73:B4:12:F3
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.c.artfiles.de, DNS:c.artfiles.de

Meta - Rostocker-fruehling.de

Number of occurences: 12
  • Name:
    Content: https://www.facebook.com/WordPresscom
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: twitter:card
    Content: summary
  • Name: theme-color
    Content: #edf9e6
  • Name: application-name
    Content: rostocker-fruehling
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: Initiative für Demokratie und Umweltschutz
  • Name: msapplication-task
    Content: name= WordPress.com Forum;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: Willkommen | rostocker-fruehling bei WordPress.com
  • Name: description
    Content: diese website ist grad in Überarbeitung ...   Rettet die Natur in den Wall-Anlagen vor den Umbauten! Liebe Freundinnen und Freunde des rostocker frühling, kommt alle zum Bürgerforum zum Thema Wallanlagen: die Planungen zur Dreiwallbastion und zur Heubastion werden vorgestellt und diskutiert: am Dienstag, 11. August 2015, um 17:00 Uhr, im Kulturhistorischen Museum, im Kapitelsaal.…

Server / Hosting

  • IP: 192.0.78.13
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • auth1.artfiles.de
  • auth2.artfiles.de
  • mailin3.dcpserver.de
  • mailin.dcpserver.de

Target

  • hostmaster.artfiles.de

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Sat, 03 Sep 2016 08:22:49 GMT Server: Apache Location: http://rostockerfruehlingdotcom.wordpress.com Content-Length: 253 Content-Type: text/html; charset=iso-8859-1 X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Via: 1.1 s_wx1123 (squid/3.5.20) Connection: keep-alive HTTP/1.1 301 Moved Permanently Server: nginx Date: Sat, 03 Sep 2016 08:22:49 GMT Content-Type: text/html Content-Length: 178 Location: https://rostockerfruehlingdotcom.wordpress.com/ X-ac: 1.fra _dca X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Via: 1.1 s_wx1123 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Sat, 03 Sep 2016 08:22:50 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 1.fra _dca Strict-Transport-Security: max-age=15552000

DNS

host: rostocker-fruehling.de
  1. class: IN
  2. ttl: 86400
  3. type: A
  4. ip: 212.53.129.188
host: rostocker-fruehling.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: auth1.artfiles.de
host: rostocker-fruehling.de
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: auth2.artfiles.de
host: rostocker-fruehling.de
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: auth1.artfiles.de
  5. rname: hostmaster.artfiles.de
  6. serial: 2012011001
  7. refresh: 28800
  8. retry: 14400
  9. expire: 806400
  10. minimum-ttl: 86400
host: rostocker-fruehling.de
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 20
  5. target: mailin3.dcpserver.de
host: rostocker-fruehling.de
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 10
  5. target: mailin.dcpserver.de

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ostocker-fruehling.de, www.riostocker-fruehling.de, www.iostocker-fruehling.de, www.roostocker-fruehling.de, www.oostocker-fruehling.de, www.rlostocker-fruehling.de, www.lostocker-fruehling.de, www.rlostocker-fruehling.de, www.lostocker-fruehling.de, www.r.ostocker-fruehling.de, www..ostocker-fruehling.de, www.rstocker-fruehling.de, www.robstocker-fruehling.de, www.rbstocker-fruehling.de, www.rohstocker-fruehling.de, www.rhstocker-fruehling.de, www.rogstocker-fruehling.de, www.rgstocker-fruehling.de, www.rojstocker-fruehling.de, www.rjstocker-fruehling.de, www.romstocker-fruehling.de, www.rmstocker-fruehling.de, www.ro stocker-fruehling.de, www.r stocker-fruehling.de, www.rovstocker-fruehling.de, www.rvstocker-fruehling.de, www.rotocker-fruehling.de, www.rosetocker-fruehling.de, www.roetocker-fruehling.de, www.roswtocker-fruehling.de, www.rowtocker-fruehling.de, www.rosdtocker-fruehling.de, www.rodtocker-fruehling.de, www.rosxtocker-fruehling.de, www.roxtocker-fruehling.de, www.rosftocker-fruehling.de, www.roftocker-fruehling.de, www.rosgtocker-fruehling.de, www.rogtocker-fruehling.de, www.rosttocker-fruehling.de, www.rottocker-fruehling.de, www.rosocker-fruehling.de, www.rostqocker-fruehling.de, www.rosqocker-fruehling.de, www.rostaocker-fruehling.de, www.rosaocker-fruehling.de, www.rost ocker-fruehling.de, www.ros ocker-fruehling.de, www.rostwocker-fruehling.de, www.roswocker-fruehling.de, www.rosteocker-fruehling.de, www.roseocker-fruehling.de, www.rostzocker-fruehling.de, www.roszocker-fruehling.de, www.rostxocker-fruehling.de, www.rosxocker-fruehling.de, www.rostcocker-fruehling.de, www.roscocker-fruehling.de, www.rostcker-fruehling.de, www.rostobcker-fruehling.de, www.rostbcker-fruehling.de, www.rostohcker-fruehling.de, www.rosthcker-fruehling.de, www.rostogcker-fruehling.de, www.rostgcker-fruehling.de, www.rostojcker-fruehling.de, www.rostjcker-fruehling.de, www.rostomcker-fruehling.de, www.rostmcker-fruehling.de, www.rosto cker-fruehling.de, www.rost cker-fruehling.de, www.rostovcker-fruehling.de, www.rostvcker-fruehling.de, www.rostoker-fruehling.de, www.rostocdker-fruehling.de, www.rostodker-fruehling.de, www.rostocrker-fruehling.de, www.rostorker-fruehling.de, www.rostoctker-fruehling.de, www.rostotker-fruehling.de, www.rostocvker-fruehling.de, www.rostovker-fruehling.de, www.rostocfker-fruehling.de, www.rostofker-fruehling.de, www.rostocgker-fruehling.de, www.rostogker-fruehling.de, www.rostochker-fruehling.de, www.rostohker-fruehling.de, www.rostocnker-fruehling.de, www.rostonker-fruehling.de, www.rostocmker-fruehling.de, www.rostomker-fruehling.de, www.rostocjker-fruehling.de, www.rostojker-fruehling.de, www.rostocer-fruehling.de, www.rostockter-fruehling.de, www.rostocter-fruehling.de, www.rostocker-fruehling.de, www.rostocer-fruehling.de, www.rostockger-fruehling.de, www.rostocger-fruehling.de, www.rostockber-fruehling.de, www.rostocber-fruehling.de, www.rostockner-fruehling.de, www.rostocner-fruehling.de, www.rostockher-fruehling.de, www.rostocher-fruehling.de, www.rostockyer-fruehling.de, www.rostocyer-fruehling.de, www.rostockler-fruehling.de, www.rostocler-fruehling.de, www.rostockoer-fruehling.de, www.rostocoer-fruehling.de, www.rostockuer-fruehling.de, www.rostocuer-fruehling.de, www.rostockier-fruehling.de, www.rostocier-fruehling.de, www.rostockmer-fruehling.de, www.rostocmer-fruehling.de, www.rostockr-fruehling.de, www.rostockexr-fruehling.de, www.rostockxr-fruehling.de, www.rostockesr-fruehling.de, www.rostocksr-fruehling.de, www.rostockewr-fruehling.de, www.rostockwr-fruehling.de, www.rostockerr-fruehling.de, www.rostockrr-fruehling.de, www.rostockefr-fruehling.de, www.rostockfr-fruehling.de, www.rostockevr-fruehling.de, www.rostockvr-fruehling.de, www.rostockecr-fruehling.de, www.rostockcr-fruehling.de, www.rostockeqr-fruehling.de, www.rostockqr-fruehling.de, www.rostockear-fruehling.de, www.rostockar-fruehling.de, www.rostockeyr-fruehling.de, www.rostockyr-fruehling.de, www.rostocke-fruehling.de, www.rostockeri-fruehling.de, www.rostockei-fruehling.de, www.rostockero-fruehling.de, www.rostockeo-fruehling.de, www.rostockerl-fruehling.de, www.rostockel-fruehling.de, www.rostockerl-fruehling.de, www.rostockel-fruehling.de, www.rostocker.-fruehling.de, www.rostocke.-fruehling.de, www.rostockerfruehling.de, www.rostocker-tfruehling.de, www.rostockertfruehling.de, www.rostocker-gfruehling.de, www.rostockergfruehling.de, www.rostocker-hfruehling.de, www.rostockerhfruehling.de, www.rostocker-ufruehling.de, www.rostockerufruehling.de, www.rostocker-jfruehling.de, www.rostockerjfruehling.de, www.rostocker-xfruehling.de, www.rostockerxfruehling.de, www.rostocker-sfruehling.de, www.rostockersfruehling.de, www.rostocker-afruehling.de, www.rostockerafruehling.de, www.rostocker-fruehling.de, www.rostockerfruehling.de, www.rostocker- fruehling.de, www.rostocker fruehling.de,

Other websites we recently analyzed

  1. Get Money Empire Inc. - Home
    San Francisco (United States) - 199.34.228.68
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, Javascript, Php, SVG, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 5
    Number of meta tags: 1
  2. vuki.science
    Austin (United States) - 209.99.40.219
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  3. Huron Valley Cabling and Consulting
    Business for Telephone and Computer Cabling
    Mountain View (United States) - 74.125.206.121
    Server software: ghs
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 3
  4. physiciansadvancedfitnessmedicine.com
    Provo (United States) - 198.57.247.164
    Server software: nginx/1.10.1
    Technology: Html
    Number of meta tags: 2
  5. Sie werden weitergeleitet auf
    Germany - 134.119.245.118
    Server software: Apache/2.4.20
    Technology: Php
    Number of meta tags: 1
  6. lifestyle-urlaub
    Germany - 91.198.157.170
    G Analytics ID: UA-9440081-33
    Server software: Apache/2.2.21 (Win32) PHP/5.3.8 mod_perl/2.0.4 Perl/v5.10.1
    Technology: Html, Google Analytics
    Number of meta tags: 3
  7. czxtx.com
    Hong Kong - 103.61.240.87
    Server software: Microsoft-IIS/6.0
    Technology: Html, Html5, Javascript
    Number of meta tags: 1
  8. orangesunteamwear.net
    Switzerland - 141.8.224.25
    Server software: Apache
    Technology: Google Adsense, CSS, Html, Javascript, Php
    Number of Javascript: 4
    Number of meta tags: 2
  9. Affordable Car Care Auto Repair Walton Hills Ohio
    Affordable Car Care is a family owned business delivering honest & professional auto repair & maintenance services to the people of Walton Hills, Macedonia, Sagamore Hills, Northfield, Solon, and surrounding areas.
    Phoenix (United States) - 69.50.216.99
    Server software: Apache
    Technology: CSS, Html, Javascript, Share This Social Media Buttons
    Number of Javascript: 4
    Number of meta tags: 4
  10. Fastshop 24
    Shop powered by PrestaShop
    Germany - 82.165.104.11
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, Prestashop
    Number of Javascript: 12
    Number of meta tags: 5

Check Other Websites